BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0845.Seq (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.5 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 6.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.9 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 647 VINVPPRNSQLPRSA--SIAAAEKHANPRVVPSRAVIMIDGSTTLTYST 507 V+N+ ++ + R++ S+ V+ +R V+ DGS T YS+ Sbjct: 545 VVNLKSGSNTIERNSHESVFVVPDEVPSDVLYNRLVVSEDGSETFKYSS 593 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 647 VINVPPRNSQLPRSA--SIAAAEKHANPRVVPSRAVIMIDGSTTLTYST 507 V+N+ ++ + R++ S+ V+ +R V+ DGS T YS+ Sbjct: 545 VVNLKSGSNTIERNSHESVFVVPDEVPSDVLYNRLVVSEDGSETFKYSS 593 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 6.0 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +1 Query: 457 RLSTWIWINIRHEHGSPVE----YVSVVDPSIIITALLGTTLGFAC 582 R + W W HE +P E VS V P + GT F+C Sbjct: 26 RPAWWFWTATSHEASAPAEGKFKTVSKV-PGPFSLPIFGTRWIFSC 70 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 507 RGPMLMPDVNPN 472 RGPM D NPN Sbjct: 856 RGPMTNDDFNPN 867 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,654 Number of Sequences: 438 Number of extensions: 3883 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -