BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0841X.Seq (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 56 9e-10 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 27 0.48 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 5.9 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 5.9 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 55.6 bits (128), Expect = 9e-10 Identities = 31/91 (34%), Positives = 54/91 (59%), Gaps = 4/91 (4%) Frame = +1 Query: 232 RRGRKRHEDFPEFLTMMA--RKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLG 405 +RG K+ + F EFL + + +K K+ E+ E +++DK+ +G + AEL H +T LG Sbjct: 57 KRGEKKIK-FEEFLPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALG 115 Query: 406 EKLTDEEVDEMIREA--DIDGDGQVNYEQFV 492 E+L D E+D ++++ D DG + Y F+ Sbjct: 116 ERLDDVELDNVMKDCMDPEDDDGNIPYAPFL 146 Score = 37.9 bits (84), Expect = 2e-04 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +2 Query: 65 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPT 199 MA+ L + +I + + FS++D +G G + +LG +R+L NPT Sbjct: 1 MANDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPT 45 Score = 35.1 bits (77), Expect = 0.001 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = +2 Query: 98 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAEL----QDMINEVDADGN 247 +F E L+DK+ DGT+ EL + +LG+ + EL +D ++ D DGN Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPEDDDGN 139 Score = 30.3 bits (65), Expect = 0.039 Identities = 19/71 (26%), Positives = 38/71 (53%) Frame = +1 Query: 280 MARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID 459 MA +KD + E+ + F V+D +G+G + A +L + + L T E + +M Sbjct: 1 MANDLKDVEIEKA-QFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKM-GGTQKR 58 Query: 460 GDGQVNYEQFV 492 G+ ++ +E+F+ Sbjct: 59 GEKKIKFEEFL 69 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 26.6 bits (56), Expect = 0.48 Identities = 22/100 (22%), Positives = 43/100 (43%) Frame = +1 Query: 175 EVARTEPHRSRTSRHDQ*SRRGRKRHEDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDG 354 EVA T + R R + E E+L + ++K + E+E ++ +DK Sbjct: 161 EVAGTRVYDERKEESMNLLRESEGKLEKISEYLRTIEDRLKTLEEEKEELSEYQKWDK-- 218 Query: 355 NGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQV 474 + L +V+ K T ++++E+ + GD Q+ Sbjct: 219 ----ARRTLEYVIYETELKETRKQLEELDGQRKSSGDKQL 254 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 343 DKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ 471 D++GN E T +G +++ +VD +RE + GQ Sbjct: 1061 DQEGNDMEREVETSDEFTGIGIRVSFTQVDAEMREMNQLSGGQ 1103 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.0 bits (47), Expect = 5.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 295 SSCAPSLSRTRESLRAVSVRV 233 SS PSLS ESL+ ++++V Sbjct: 129 SSAEPSLSEMNESLKLLAMQV 149 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 90 RSPSLRRHSHCSTKTAMAPSRPKS 161 RSP RR S + T+ SRP S Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTS 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 410,780 Number of Sequences: 2352 Number of extensions: 7039 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -