BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0840.Seq (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0471 + 8734292-8734788,8735168-8735654,8735766-8736551 29 5.0 08_01_0505 - 4379722-4380795,4380868-4381008,4381099-4381270,438... 28 8.7 >03_02_0471 + 8734292-8734788,8735168-8735654,8735766-8736551 Length = 589 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 456 RFAFYVSDGKATHAPLLMEGGWSRTVRYNL 545 RFAFYV G + L G +S+T+RY L Sbjct: 445 RFAFYVRPGALSDVGLGYIGEFSKTIRYML 474 >08_01_0505 - 4379722-4380795,4380868-4381008,4381099-4381270, 4381944-4382047,4382127-4382259,4384477-4384653, 4385164-4385309,4385536-4385625,4385703-4385915, 4386090-4386182,4386743-4386937,4387018-4387110, 4387924-4388019,4388556-4388985,4389424-4390091, 4392074-4392271,4392690-4393407,4394036-4394181 Length = 1628 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 692 TLNGSLMASCKNVASTKYLFTFRY-IRHIFIAGDGNTI 582 T G L A N+ + L RY IRH F+A GNT+ Sbjct: 739 TETGRLSARTPNLQNQPALEKDRYKIRHAFVAAPGNTL 776 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,092,943 Number of Sequences: 37544 Number of extensions: 325609 Number of successful extensions: 610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -