BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0836X.Seq (399 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 2.6 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 3.4 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 4.5 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 21 5.9 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 5.9 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 2.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 328 ASAKGCLLSYNLNGHKVHNLNKGP 257 +S K + + + HK H+L+K P Sbjct: 260 SSEKKSSIQHGDDAHKTHHLDKNP 283 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 3.4 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 78 LGMVTLTKLE-TTYIFKLLAKQTKKCN 1 LG + L+ T+Y K L KQ ++CN Sbjct: 463 LGRAVVPTLDATSYYAKDLEKQRQQCN 489 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.0 bits (42), Expect = 4.5 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -3 Query: 205 CLVRVVRYTANYNCRRNQC*PIFNSKTKPSANRIWNW 95 C++ TA CR +C + SK+ R NW Sbjct: 48 CVINKKNRTACKACRLRKCLLVGMSKSGSRYGRRSNW 84 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 153 SANQSLTPRRNHPPTESGIGKLDR 82 + N P R+HP E + +LDR Sbjct: 342 NGNAHNCPSRSHPVWEIVMNELDR 365 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 153 SANQSLTPRRNHPPTESGIGKLDR 82 + N P R+HP E + +LDR Sbjct: 349 NGNAHNCPSRSHPVWEIVMNELDR 372 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,028 Number of Sequences: 336 Number of extensions: 1684 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -