BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0830.Seq (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1834.07 |klp3|krp1|kinesin-like protein Klp3|Schizosaccharom... 27 2.6 SPBC947.07 |||ribosome biogenesis protein Rrp14-C|Schizosaccharo... 27 3.4 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 26 5.9 SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyce... 25 7.8 >SPAC1834.07 |klp3|krp1|kinesin-like protein Klp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 554 Score = 27.1 bits (57), Expect = 2.6 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 525 PNFTIQKKSENFGLSNAQLERNKTKEQLEE-EKKISLSIRIKPLTIEGL 668 P FTI++K +NF ++N ERN ++L + ++ + ++ I+ L Sbjct: 490 PGFTIEQKDKNFSINN---ERNNFLQKLSTLDSSLAALVNVQRKLIKAL 535 >SPBC947.07 |||ribosome biogenesis protein Rrp14-C|Schizosaccharomyces pombe|chr 2|||Manual Length = 233 Score = 26.6 bits (56), Expect = 3.4 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +1 Query: 442 EEKRQRLEEAEKKRQAMLQA 501 EEKR+++EE++K + +LQA Sbjct: 138 EEKRRKIEESDKWHRVLLQA 157 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 104 CWLFIECRTGRSRSLSHSALVLGPAAQRRWNVES 3 CW I G S L+ AL+L PA+ NV S Sbjct: 292 CWWIIPMALGSSAGLACRALLLNPASVTYPNVLS 325 >SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 642 Score = 25.4 bits (53), Expect = 7.8 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +1 Query: 448 KRQRLEEAEKKRQAMLQAMKV---PARPDPTSPSKRRAKTS 561 KR+ E +KK +M + +KV P + D SP K++ TS Sbjct: 5 KRKESTEVKKKDGSMNKRVKVAKLPKKVDSFSPKKKKNTTS 45 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,862,779 Number of Sequences: 5004 Number of extensions: 25187 Number of successful extensions: 119 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -