BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0828.Seq (613 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024826-8|AAF60795.2| 580|Caenorhabditis elegans Hypothetical ... 31 0.86 AL132904-14|CAC35847.2| 258|Caenorhabditis elegans Hypothetical... 29 3.5 AF242767-1|AAG36874.1| 258|Caenorhabditis elegans SF2 protein. 29 3.5 >AC024826-8|AAF60795.2| 580|Caenorhabditis elegans Hypothetical protein Y55F3AM.3a protein. Length = 580 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = +1 Query: 157 RDRVECCSSLEQESTIKERGFQRQRAKNRLSGRGPLREQPPYSGFLGPRCRKALNRNPKG 336 RDR S + R R+R + R P R PP S GP R + NP+ Sbjct: 93 RDRGAPRRRSRTRSRDRRRSPPRRRDRRTPPRRSPGRRSPPRSRLPGPERRDVMPFNPRH 152 Query: 337 SP 342 SP Sbjct: 153 SP 154 >AL132904-14|CAC35847.2| 258|Caenorhabditis elegans Hypothetical protein Y111B2A.18 protein. Length = 258 Score = 28.7 bits (61), Expect = 3.5 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = -2 Query: 549 RKINK*GFRAHFPESAT*RAL*RRIKRGGCGGYAQRDRYTCQRPSAR---SFRFLPFLSR 379 RK++ FR+H E+A R GG GG RDR + P A S ++ P SR Sbjct: 175 RKLDDTKFRSHEGETAYIRVREDNSSGGGSGG-GGRDRSRSRSPRAERRASPKYSPRRSR 233 Query: 378 HVRRLSPSSSKSGAPFRVPI*CFTAPRPQ 292 R S S S+S + R P +P PQ Sbjct: 234 S-RSRSRSRSRSRSASRSP---SRSPSPQ 258 >AF242767-1|AAG36874.1| 258|Caenorhabditis elegans SF2 protein. Length = 258 Score = 28.7 bits (61), Expect = 3.5 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = -2 Query: 549 RKINK*GFRAHFPESAT*RAL*RRIKRGGCGGYAQRDRYTCQRPSAR---SFRFLPFLSR 379 RK++ FR+H E+A R GG GG RDR + P A S ++ P SR Sbjct: 175 RKLDDTKFRSHEGETAYIRVREDNSSGGGSGG-GGRDRSRSRSPRAERRASPKYSPRRSR 233 Query: 378 HVRRLSPSSSKSGAPFRVPI*CFTAPRPQ 292 R S S S+S + R P +P PQ Sbjct: 234 S-RSRSRSRSRSRSASRSP---SRSPSPQ 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,250,185 Number of Sequences: 27780 Number of extensions: 270805 Number of successful extensions: 571 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -