BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0823.Seq (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 26 0.90 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 26 0.90 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 26 0.90 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 24 3.7 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 26.2 bits (55), Expect = 0.90 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 487 NNPNLNRYYALNVIINQFFVCNVRTFYNKY 576 +NPN NR ++ + F CNV F +Y Sbjct: 542 DNPNSNRDALDKMVGDYHFTCNVNEFAQRY 571 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 26.2 bits (55), Expect = 0.90 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 487 NNPNLNRYYALNVIINQFFVCNVRTFYNKY 576 +NPN NR ++ + F CNV F +Y Sbjct: 542 DNPNSNRDALDKMVGDYHFTCNVNEFAQRY 571 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 26.2 bits (55), Expect = 0.90 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 487 NNPNLNRYYALNVIINQFFVCNVRTFYNKY 576 +NPN NR ++ + F CNV F +Y Sbjct: 428 DNPNSNRDALDKMVGDYHFTCNVNEFAQRY 457 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 11 LTLTNRFERFHSFAIGGC 64 L L+NRF R+ F +G C Sbjct: 263 LILSNRFGRYQPFLVGYC 280 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,529 Number of Sequences: 2352 Number of extensions: 10717 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -