BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0820.Seq (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 3.6 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 6.4 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 21 8.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.4 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 8.4 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 8.4 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 743 LINSFMARICFLVFVGKTVLKLRKFIYLCTL*IGMKNQVSDYFFYW 606 LI F C +V GK +L + + +G +QV+DY W Sbjct: 227 LIGGFWFMQCDVV--GKVASQLAEDFQMALKHVGPSSQVADYRSLW 270 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 6.4 Identities = 5/10 (50%), Positives = 10/10 (100%) Frame = -2 Query: 64 ICFNAFLYSF 35 +CFN+++Y+F Sbjct: 62 VCFNSYMYAF 71 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 103 ILQEIIDKSYVNKISN 150 +LQEII KSY +N Sbjct: 51 LLQEIIPKSYFGTTTN 66 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 103 ILQEIIDKSYVNKISN 150 +LQEII KSY +N Sbjct: 51 LLQEIIPKSYFGTTTN 66 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 201 AACKLDISDGQTFSFQTINLDP 266 AACKL S+GQ S + N P Sbjct: 74 AACKLYSSEGQQNSNYSSNSKP 95 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -1 Query: 740 INSFMARICFLVFVGKTVLKLRKFIYLCTL*IGMKNQV 627 ++ F + FLV + + L+ IY+ + IG KN + Sbjct: 205 VDLFNSLFGFLVLLLVALTTLQLLIYIQVIVIGTKNTI 242 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,789 Number of Sequences: 336 Number of extensions: 3587 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -