BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0820.Seq (782 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL023835-9|CAA19493.2| 397|Caenorhabditis elegans Hypothetical ... 28 8.7 >AL023835-9|CAA19493.2| 397|Caenorhabditis elegans Hypothetical protein Y37A1B.10 protein. Length = 397 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = -1 Query: 428 VYITLLKI*RP*ISRI*HISY*YNNMIMNTFTHN----GQKTRYYSHYTLNY 285 VY+ ++ I + + HI+Y Y + I++T+ HN G K Y S T Y Sbjct: 67 VYVLMIGITSSDLYTMFHINYVYIDTIISTYLHNKMYEGYKCWYISRVTHGY 118 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,167,788 Number of Sequences: 27780 Number of extensions: 291974 Number of successful extensions: 412 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1893203640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -