BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0819.Seq (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.4 AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-tran... 24 4.5 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 544 VYRLKLTKQ*RKYTMMVHQLRGPLNMFQVKLVQRRLKK 657 V++L Q KY + + ++GPLN + Q+ K+ Sbjct: 970 VFKLHYKVQNNKYVLKLKSMKGPLNNSLTEQKQKSYKQ 1007 >AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-transferase E3 protein. Length = 223 Score = 24.2 bits (50), Expect = 4.5 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 349 VWFLDHDYLENMYGMFKKVNAREKVVGWYHTGPKLHQNDIAINELIRRY 495 V ++D ENM + K+N V G L+ + IN L+++Y Sbjct: 31 VQYIDLAKKENMTEEYLKMNPMHTVPTVNDNGVPLYDSHAIINYLVQKY 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 756,291 Number of Sequences: 2352 Number of extensions: 14280 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -