BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0807.Seq (740 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0036 + 3217163-3217584,3217752-3218322 30 1.7 12_02_1074 - 25849280-25849324,25849435-25849506,25849601-258496... 29 5.1 12_02_0054 - 12943867-12944283 28 6.8 09_01_0066 - 978018-978500,978588-979034,979113-979412,979521-97... 28 6.8 10_08_0938 + 21693629-21694360,21694558-21694613,21694836-21694869 28 9.0 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 28 9.0 01_05_0727 - 24639335-24639419,24639605-24639692,24640142-246402... 28 9.0 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 419 ITIHWPSFYNVV-TGKTLALPNLIALQH 499 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >12_02_1074 - 25849280-25849324,25849435-25849506,25849601-25849663, 25849756-25849865,25850648-25850761,25851601-25851681, 25851736-25851850 Length = 199 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 Query: 162 TSLSRCCISCFGCRVL*LIKRTSGSINCNCKLSRGYPDC*SQNRVNR*SSLPHISQG 332 T + + C GCR L + R + S+ C+C C + N V SS+ H++ G Sbjct: 65 TGMDIAHLICGGCRTLLMYTRNATSVRCSC--------CDTVNLVRPVSSIAHLNCG 113 >12_02_0054 - 12943867-12944283 Length = 138 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -1 Query: 593 LQFAIRHSAAQLLGRAIGAGLFAITPAGEG--GCAARRL 483 ++ +R +A Q L A+G G+ I P G G G RRL Sbjct: 76 VEACLRVAAGQPLDLAVGEGVMVIVPVGSGEEGSRGRRL 114 >09_01_0066 - 978018-978500,978588-979034,979113-979412,979521-979855, 980325-980703 Length = 647 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 502 PPSPAGVIAKRPAPIALPNSCAAEWRMANCKR 597 PPSP +RP A P + AA +R C+R Sbjct: 49 PPSPTPPARRRPTKPASPPTGAALYRARRCRR 80 >10_08_0938 + 21693629-21694360,21694558-21694613,21694836-21694869 Length = 273 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 490 LAAHP-PSPAGVIAKRPAPIALPNSCAAEWRMAN 588 LA P PSP G RPAP++LP W A+ Sbjct: 26 LAPSPSPSPPGTGRVRPAPVSLPPRPPLLWAAAS 59 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 496 AHPPSPAGVIAKRPAPIALPNSCAA 570 A P+P V A P P+A PN C + Sbjct: 249 APAPAPPPVTAPPPPPVAAPNDCVS 273 >01_05_0727 - 24639335-24639419,24639605-24639692,24640142-24640225, 24640263-24640329 Length = 107 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 125 RTLVNVQLQHFVHFFKQMLHIMFRMPRTV 211 R VN Q+FVHF ++ I+FRM R V Sbjct: 49 RKEVNSTAQNFVHFTEEEEDIVFRMHRLV 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,361,549 Number of Sequences: 37544 Number of extensions: 464865 Number of successful extensions: 1499 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1499 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -