BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0807.Seq (740 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X14459-1|CAB37631.1| 494|Drosophila melanogaster protein ( Dros... 29 8.8 X14458-1|CAA32627.1| 489|Drosophila melanogaster protein ( Dros... 29 8.8 X07870-1|CAA30720.1| 494|Drosophila melanogaster bcd protein. 29 8.8 BT021332-1|AAX33480.1| 494|Drosophila melanogaster RE03232p pro... 29 8.8 AY058658-1|AAL13887.1| 489|Drosophila melanogaster LD36304p pro... 29 8.8 AF466645-1|AAL77032.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466644-1|AAL77031.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466643-1|AAL77030.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466642-1|AAL77029.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466641-1|AAL77028.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466640-1|AAL77027.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466639-1|AAL77026.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466638-1|AAL77025.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466637-1|AAL77024.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466636-1|AAL77023.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466635-1|AAL77022.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466634-1|AAL77021.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466633-1|AAL77020.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466632-1|AAL77019.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466631-1|AAL77018.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466630-1|AAL77017.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466629-1|AAL77016.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466628-1|AAL77015.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466627-1|AAL77014.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466626-1|AAL77013.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466625-1|AAL77012.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466624-1|AAL77011.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466623-1|AAL77010.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466622-1|AAL77009.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AF466621-1|AAL77008.1| 489|Drosophila melanogaster bicoid protein. 29 8.8 AE014297-515|AAN13371.2| 418|Drosophila melanogaster CG1034-PE,... 29 8.8 AE014297-514|AAO41514.1| 413|Drosophila melanogaster CG1034-PF,... 29 8.8 AE014297-513|AAF54085.2| 494|Drosophila melanogaster CG1034-PG,... 29 8.8 AE014297-512|AAN13369.1| 489|Drosophila melanogaster CG1034-PD,... 29 8.8 AE001572-8|AAD19798.1| 494|Drosophila melanogaster DNA-binding-... 29 8.8 >X14459-1|CAB37631.1| 494|Drosophila melanogaster protein ( Drosophila c53.46.9bcd (bicoid) mRNA (major 2.6 kb transcript). ). Length = 494 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 352 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 381 >X14458-1|CAA32627.1| 489|Drosophila melanogaster protein ( Drosophila c53.46.6,7 bcd (bicoid) mRNA (major 2.6 kb transcript). ). Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >X07870-1|CAA30720.1| 494|Drosophila melanogaster bcd protein. Length = 494 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 352 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 381 >BT021332-1|AAX33480.1| 494|Drosophila melanogaster RE03232p protein. Length = 494 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 352 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 381 >AY058658-1|AAL13887.1| 489|Drosophila melanogaster LD36304p protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466645-1|AAL77032.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466644-1|AAL77031.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466643-1|AAL77030.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466642-1|AAL77029.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466641-1|AAL77028.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466640-1|AAL77027.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466639-1|AAL77026.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466638-1|AAL77025.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466637-1|AAL77024.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466636-1|AAL77023.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466635-1|AAL77022.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466634-1|AAL77021.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466633-1|AAL77020.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466632-1|AAL77019.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466631-1|AAL77018.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466630-1|AAL77017.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466629-1|AAL77016.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466628-1|AAL77015.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466627-1|AAL77014.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466626-1|AAL77013.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466625-1|AAL77012.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466624-1|AAL77011.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466623-1|AAL77010.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466622-1|AAL77009.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AF466621-1|AAL77008.1| 489|Drosophila melanogaster bicoid protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AE014297-515|AAN13371.2| 418|Drosophila melanogaster CG1034-PE, isoform E protein. Length = 418 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 276 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 305 >AE014297-514|AAO41514.1| 413|Drosophila melanogaster CG1034-PF, isoform F protein. Length = 413 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 271 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 300 >AE014297-513|AAF54085.2| 494|Drosophila melanogaster CG1034-PG, isoform G protein. Length = 494 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 352 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 381 >AE014297-512|AAN13369.1| 489|Drosophila melanogaster CG1034-PD, isoform D protein. Length = 489 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 347 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 376 >AE001572-8|AAD19798.1| 494|Drosophila melanogaster DNA-binding-protein,transcription-factor protein. Length = 494 Score = 28.7 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 166 EVDKMLQLNVDERPLICGVGLGGYWAERIG 77 EV + L DE P +CG+G+GG A +G Sbjct: 352 EVYEPLTPKNDESPSLCGIGIGGPCAIAVG 381 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,757,114 Number of Sequences: 53049 Number of extensions: 752452 Number of successful extensions: 2386 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 2282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2383 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -