BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0807.Seq (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL023837-1|CAA19499.1| 718|Caenorhabditis elegans Hypothetical ... 29 2.6 Z82286-2|CAB05306.1| 397|Caenorhabditis elegans Hypothetical pr... 28 6.0 >AL023837-1|CAA19499.1| 718|Caenorhabditis elegans Hypothetical protein Y37H2C.1 protein. Length = 718 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -2 Query: 262 RESLQLQFIDPDVRLISYSTRHPKHDMQHLLKEVDKMLQLNVDERPLICGVGLGGYWA 89 ++ LQF D + + YS + +H + VD L+L + IC +G GY+A Sbjct: 470 QQKSMLQFYDYTILWLQYSALLWIYSKRHGMFVVDSSLRLIIKIVFSICSIGFTGYFA 527 >Z82286-2|CAB05306.1| 397|Caenorhabditis elegans Hypothetical protein W02A2.3 protein. Length = 397 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 60 RMSQRKPIRSAQYPPKPTPQISGRSSTFSCNILSTSLSRCCISC 191 R +Q++P+R +QYP P PQ + + T S N ISC Sbjct: 163 RSAQQQPLRFSQYPSCPCPQ-NQPACTCSTNNQQNEQILVSISC 205 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,598,891 Number of Sequences: 27780 Number of extensions: 377915 Number of successful extensions: 1084 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -