BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0802X.Seq (510 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U61151-1|AAB41306.1| 45|Tribolium castaneum TATH1 protein. 22 2.8 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 2.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 3.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 3.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 6.4 >U61151-1|AAB41306.1| 45|Tribolium castaneum TATH1 protein. Length = 45 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 191 RVFPLSSTFT*ALSIFPNISNERYNSSFET 102 R+ L+ F + P++ N+R S FET Sbjct: 9 RMNSLNDAFDRLRDVVPSLGNDRKLSKFET 38 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -3 Query: 283 RDDVKKKHFSCSYELQIRHLVCV 215 R+D+++ +F S+ L I +VC+ Sbjct: 312 RNDLERLYFYWSFALLITRIVCL 334 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 69 IVWXKPYSQGSTVPQFSIQFTFC 1 IV+ ++QG T P F++ + +C Sbjct: 140 IVFILFFAQGLTSPIFNLVYVYC 162 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +3 Query: 354 KKHPEFTKARELGPRFSELNSFEHEYGTRWKQLHE 458 K+ P+ RE P F++ + +YG+ W H+ Sbjct: 207 KERPDSIYQREYSPTFTQQQTQYSQYGS-WFLPHQ 240 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.0 bits (42), Expect = 6.4 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 326 EFIRFFKAFNNDW 288 E+ F+K+ NDW Sbjct: 297 EYGEFYKSLTNDW 309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,733 Number of Sequences: 336 Number of extensions: 2064 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -