BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0802X.Seq (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 4.5 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 4.5 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 435 FHIHVRNYLTLRNVVQAHELS*ILDVSWEDSFQ 337 F IH+ + L+N+ +AH LD+ DS+Q Sbjct: 846 FTIHLTADVPLQNLPKAHTCFNRLDLPMYDSYQ 878 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 112 ELLYRSFEIFGKIERAYVKVDE 177 EL+ +FE FG++ A + VD+ Sbjct: 698 ELVREAFEAFGRVSGARLNVDK 719 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,118 Number of Sequences: 2352 Number of extensions: 7814 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -