BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0801X.Seq (459 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 30 1.0 11_05_0017 - 18416977-18417936 27 7.3 08_02_0922 + 22646822-22647742 27 9.6 >02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 Length = 229 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 422 RPGARSSRFLPFLSRHVRRLSPSSSKSGAP 333 R A R+ PFLSR +R S S+ SG P Sbjct: 191 RRSATDGRYAPFLSRQPQRSSAGSTHSGKP 220 >11_05_0017 - 18416977-18417936 Length = 319 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 277 GDGSRSGPRPDRRFFAL*RWSP 212 G R GP RRFF RW+P Sbjct: 275 GVARRPGPTQGRRFFGCGRWTP 296 >08_02_0922 + 22646822-22647742 Length = 306 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 186 EQESTIKERGLQRQR-AKNRLSGRGPLREPSP 278 E+E++ KE+ + Q+ AK +L GRG PSP Sbjct: 215 EEETSRKEKRPEGQKKAKAKLKGRGKNAAPSP 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,853,517 Number of Sequences: 37544 Number of extensions: 214626 Number of successful extensions: 468 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -