BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0797.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 30 1.7 At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containi... 28 5.2 At1g14740.1 68414.m01762 expressed protein 28 5.2 At1g50830.1 68414.m05716 hypothetical protein 28 6.8 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 27 9.0 At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 27 9.0 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 9.0 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 455 RNDRKSRHRRIKKQRRYEAWLPQASYPC 538 R +RKS ++ +KK+ E+W ++S+PC Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161 >At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 907 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 637 ASFCLLLHARFLSSLSWP 690 ASFC+L+HA ++L WP Sbjct: 105 ASFCILIHALVKANLFWP 122 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 28.3 bits (60), Expect = 5.2 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = -3 Query: 336 YCSVREEPQFRTFGSCTRP-SGRWCEATTAGLCLNASKAEASLAESGKDMLTVEPRESGG 160 + +VR F S + P SG E T + LC N+ K SL + GK+++T S Sbjct: 46 FLNVRSNNLDGGFSSKSSPRSGN--ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYD 103 Query: 159 SK--QCDFTSRVSHSKRETRRRS 97 K + DF + + ++R++ Sbjct: 104 DKWVERDFFNLREMNPNSSKRKA 126 >At1g50830.1 68414.m05716 hypothetical protein Length = 768 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +2 Query: 161 PPDSRGSTVSISLPDSARLASALEAFRHNPAVVASHHRPLGRVHEPNVRNC 313 P SR + + P + RLA E PA++A +R L R+HE + +C Sbjct: 225 PVKSRRNISNHVFPIAVRLARG-ERIALAPAILAILYRDLDRIHEVSREDC 274 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 651 KAKAGLIQMFSTHRDCESTAYRSFSIK 571 +AK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 511 SFIATLLFDPSMSALPIIAKQNSPSVGLFT 422 S + LL P + L I+ QN P+VGLFT Sbjct: 7 SVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 227 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 87 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,114,070 Number of Sequences: 28952 Number of extensions: 314198 Number of successful extensions: 842 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -