BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0796.Seq (754 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 31 0.82 At4g33630.2 68417.m04778 expressed protein 28 7.7 At4g33630.1 68417.m04777 expressed protein 28 7.7 At2g02890.1 68415.m00239 F-box family protein contains Pfam PF00... 28 7.7 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 31.1 bits (67), Expect = 0.82 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 154 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREP 273 D+D E CS+ E ES ++E L +++A N++ GR L P Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGRDLLVTP 472 >At4g33630.2 68417.m04778 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 420 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 322 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At4g33630.1 68417.m04777 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 420 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 322 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At2g02890.1 68415.m00239 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 531 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 530 PYLFIFLNTFKYVSAHETITLINASIILKKEEYEYSTF 643 P L F TF + +E +NAS+ + +E YS+F Sbjct: 97 PALLCFCETFGSLKGYEVENHMNASVTMLEEAIMYSSF 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,634,572 Number of Sequences: 28952 Number of extensions: 320986 Number of successful extensions: 738 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -