BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0795.Seq (680 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q57W75 Cluster: Bis(5'-adenosyl)-triphosphatase, putati... 33 4.9 UniRef50_Q7RKY1 Cluster: Axonemal heavy chain dynein type 3; n=8... 33 6.4 >UniRef50_Q57W75 Cluster: Bis(5'-adenosyl)-triphosphatase, putative; n=1; Trypanosoma brucei|Rep: Bis(5'-adenosyl)-triphosphatase, putative - Trypanosoma brucei Length = 416 Score = 33.5 bits (73), Expect = 4.9 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +3 Query: 423 ICISKLPCLLLSP-LRGTGDAPSLSGAETSRGAARHSDGAPL 545 + IS L +L+ P + GTGD S G+ RG + HS G+P+ Sbjct: 286 LTISVLSHVLVKPAVTGTGDTSSNGGSRVERGCSPHSIGSPV 327 >UniRef50_Q7RKY1 Cluster: Axonemal heavy chain dynein type 3; n=8; cellular organisms|Rep: Axonemal heavy chain dynein type 3 - Plasmodium yoelii yoelii Length = 3690 Score = 33.1 bits (72), Expect = 6.4 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = -2 Query: 352 IIKHTSDLNVRSDI*TSFIPLNSHFHDLRAHLIHENFVYT*LENGVMMTYNKLFKVKFSY 173 II + DL++ S I + L ++F + H++ F+ ++ + + N LF F+ Sbjct: 1083 IILNNCDLSIASYICSYINTLPNNFDPIHKHILLNLFMCLFHKSLLFICINNLFVYAFNE 1142 Query: 172 YYYC 161 YYYC Sbjct: 1143 YYYC 1146 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,065,539 Number of Sequences: 1657284 Number of extensions: 10216975 Number of successful extensions: 22257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22248 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52892566912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -