BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0795.Seq (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) 30 1.5 SB_7818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/60 (25%), Positives = 34/60 (56%) Frame = -2 Query: 583 TICVNIILYYNYVNGAPSE*RAAPRDVSAPLRLGASPVPRSGLSKRHGSLDMHILLSLIL 404 T+C++ +L++N +N + + + AP+R +PVP S + ++ ++LSL++ Sbjct: 352 TLCISPLLHFNLINDSTKQSESHCYVSIAPIR---TPVPESSVDQKASMFASEVVLSLVV 408 >SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) Length = 1014 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 271 LRAHLIHENFVYT*LENGVMMTYNKLFKVKF 179 LR H H F+ L++G+ N LFK KF Sbjct: 930 LRTHFKHSQFIVVSLKDGMFNNANVLFKTKF 960 >SB_7818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 662 RRIDFKSHIVKLSFSSFRLIGFQKHVYDLCKYNIIL 555 R I SH+V+LS SS+RL H+ +L Y +IL Sbjct: 74 RVIVLLSHLVELSISSYRL---SNHLVELSFYRVIL 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,036,289 Number of Sequences: 59808 Number of extensions: 313642 Number of successful extensions: 625 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -