BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0793.Seq (829 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0207 + 20933319-20933427,20933503-20933701,20933785-209339... 29 4.5 05_01_0601 + 5390484-5391692 28 7.9 >02_04_0207 + 20933319-20933427,20933503-20933701,20933785-20933931, 20934683-20934764,20935542-20935697,20935948-20936121, 20936278-20936349,20937012-20937083,20937322-20937440, 20937540-20937625,20937747-20937799,20938076-20938153 Length = 448 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 358 EDGTVIPGDLPARDVPQMITITFDDA 435 EDG + GD R VP ++T FDDA Sbjct: 48 EDGQLGHGDAEDRPVPTVLTAAFDDA 73 >05_01_0601 + 5390484-5391692 Length = 402 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 203 GDSTCIERGLFCNGEKDLAMDLMKILVILTTTQIELRHAIPRSVSFL 343 G + C RG++C+ D A ++ + + LR +P +VS L Sbjct: 63 GPNVCAYRGVYCSAPPDDAAASGAVVAGIDLNRANLRGTLPAAVSLL 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,442,602 Number of Sequences: 37544 Number of extensions: 478129 Number of successful extensions: 1365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -