BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0788.Seq (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.8 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 5.0 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 3.8 Identities = 20/73 (27%), Positives = 27/73 (36%), Gaps = 9/73 (12%) Frame = +2 Query: 41 KNVSAAIHPGIPTEPPSRSGLRTGAYSGRSPDGRHHAN---------DVQRLLPSVEADG 193 + V A++ P P P S AY+ D H D + LLP V G Sbjct: 172 QTVVASMDPPEPPVPTVTSACVGSAYTPLKEDHDDHYGVPTLEELGFDTEGLLPPVWVGG 231 Query: 194 DRQ*RRRFHHHLE 232 + + R HLE Sbjct: 232 ESEALARLERHLE 244 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 499 NSSLVLRGSRSPGSDHGQHTVRGQPRFDSVRVAVF 395 N S ++ GS +PG+ + P F RVA + Sbjct: 385 NRSGLVSGSSTPGTGREHDPAKFPPSFRISRVAAY 419 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,983 Number of Sequences: 438 Number of extensions: 3438 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -