BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0784.Seq (522 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 25 0.36 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 25 0.62 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 25.4 bits (53), Expect = 0.36 Identities = 10/42 (23%), Positives = 26/42 (61%) Frame = -3 Query: 322 HILHLFVKGIEYF*QKYRFSSFHKQMLNTNLNNFILHT*CSH 197 +++ L +K ++ Y F+ + ++L N+N+ I++T C++ Sbjct: 544 YMMALSMKLQKFINNDYNFNEVNFRILGANVNDLIMNTRCAN 585 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 24.6 bits (51), Expect = 0.62 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 318 FCICLSKGLNIFNRNIDFRP 259 +C C+ K NI ++N F+P Sbjct: 62 YCECILKNFNILDKNNVFKP 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,515 Number of Sequences: 438 Number of extensions: 3004 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -