BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0783.Seq (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62400.1 68418.m07831 hypothetical protein 29 2.1 At5g54250.2 68418.m06758 cyclic nucleotide-regulated ion channel... 29 2.1 At5g54250.1 68418.m06757 cyclic nucleotide-regulated ion channel... 29 2.1 At2g21400.1 68415.m02547 lateral root primordium (LRP) protein-r... 29 2.1 At1g16340.1 68414.m01955 2-dehydro-3-deoxyphosphooctonate aldola... 29 2.1 At4g21190.1 68417.m03064 pentatricopeptide (PPR) repeat-containi... 29 2.8 At3g49990.1 68416.m05466 expressed protein 29 3.8 At1g79500.3 68414.m09267 2-dehydro-3-deoxyphosphooctonate aldola... 29 3.8 At1g79500.2 68414.m09266 2-dehydro-3-deoxyphosphooctonate aldola... 29 3.8 At1g79500.1 68414.m09265 2-dehydro-3-deoxyphosphooctonate aldola... 29 3.8 At2g21420.1 68415.m02549 zinc finger protein-related contains lo... 28 5.0 At5g36850.1 68418.m04415 hypothetical protein similar to At1g277... 28 6.6 At3g44690.1 68416.m04806 expressed protein 28 6.6 At1g27780.1 68414.m03399 Ulp1 protease family protein similar to... 28 6.6 At5g40010.1 68418.m04852 AAA-type ATPase family protein contains... 27 8.7 At4g25730.1 68417.m03703 FtsJ-like methyltransferase family prot... 27 8.7 At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like fami... 27 8.7 >At5g62400.1 68418.m07831 hypothetical protein Length = 214 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +2 Query: 11 FSQVYEIVKVILSKDESSVGKDSDDDDIEGVRQRREQLSELKEAAYELLGKAWPKDYETQ 190 F + + +L + SSV D D++++ +R ++L+EL+EA E G D ++ Sbjct: 39 FGTRFVFTQTLLCAEISSVKDDEDEEEMLKLRFMAKRLTELEEAFKEKTGPINQLDLQSL 98 Query: 191 E 193 E Sbjct: 99 E 99 >At5g54250.2 68418.m06758 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC4) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc4) GI:4581203 from [Arabidopsis thaliana] Length = 694 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 47 SKDESSVGKDSDDDDIEGVRQRREQLSELKEAAYE 151 S+D SSVG S++D+ E + E++ E++E E Sbjct: 14 SRDSSSVGYYSEEDNTEEEDEEEEEMEEIEEEEEE 48 >At5g54250.1 68418.m06757 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC4) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc4) GI:4581203 from [Arabidopsis thaliana] Length = 694 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 47 SKDESSVGKDSDDDDIEGVRQRREQLSELKEAAYE 151 S+D SSVG S++D+ E + E++ E++E E Sbjct: 14 SRDSSSVGYYSEEDNTEEEDEEEEEMEEIEEEEEE 48 >At2g21400.1 68415.m02547 lateral root primordium (LRP) protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702) Length = 174 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 375 DGLVAVSWRDVIGVGVHGLVAVQHDEPLHHVVDGHQYGQ 259 DG +++ + +G H + HD+ LH V+ H Y + Sbjct: 97 DGKEQYAYQTTVNIGGHVFRGILHDQGLHKVMVDHHYNK 135 >At1g16340.1 68414.m01955 2-dehydro-3-deoxyphosphooctonate aldolase, putative / phospho-2-dehydro-3-deoxyoctonate aldolase, putative / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase, putative similar to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 291 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 381 GTDGLVAVSWRDVIGVGVHGLVAVQHDEPLHHVVDG 274 G L+ R + VGV G+ HD+PL+ VDG Sbjct: 218 GLRELIPCIARTAVAVGVDGIFMEVHDDPLNAPVDG 253 >At4g21190.1 68417.m03064 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 307 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +2 Query: 44 LSKDESSVGKDSD--DDDIEGVRQRREQLSELKEAAYELLG 160 LS+ E + D D D++IE + E LSE +E ELLG Sbjct: 248 LSEGEGGLSSDEDKIDNEIESEEEDGEDLSEEEEDEKELLG 288 >At3g49990.1 68416.m05466 expressed protein Length = 502 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 68 GKDSDDDDI--EGVRQRREQLSELKEAAYELLGKAWPKDYETQEKYQN 205 G DSD D E + E+ +E + GKA KDYE +EKY N Sbjct: 263 GSDSDGDGYIAEDGEEEEEEDFMAQEVQNLIHGKA--KDYELEEKYMN 308 >At1g79500.3 68414.m09267 2-dehydro-3-deoxyphosphooctonate aldolase / phospho-2-dehydro-3-deoxyoctonate aldolase / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase (KDSA) identical to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 290 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 381 GTDGLVAVSWRDVIGVGVHGLVAVQHDEPLHHVVDG 274 G L+ R + VGV G+ HD+PL VDG Sbjct: 217 GLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVDG 252 >At1g79500.2 68414.m09266 2-dehydro-3-deoxyphosphooctonate aldolase / phospho-2-dehydro-3-deoxyoctonate aldolase / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase (KDSA) identical to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 290 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 381 GTDGLVAVSWRDVIGVGVHGLVAVQHDEPLHHVVDG 274 G L+ R + VGV G+ HD+PL VDG Sbjct: 217 GLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVDG 252 >At1g79500.1 68414.m09265 2-dehydro-3-deoxyphosphooctonate aldolase / phospho-2-dehydro-3-deoxyoctonate aldolase / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase (KDSA) identical to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 290 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 381 GTDGLVAVSWRDVIGVGVHGLVAVQHDEPLHHVVDG 274 G L+ R + VGV G+ HD+PL VDG Sbjct: 217 GLRELIPCIARTAVAVGVDGIFMEVHDDPLSAPVDG 252 >At2g21420.1 68415.m02549 zinc finger protein-related contains low similarity to zinc finger proteins and Pfam PF01485: IBR domain Length = 468 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +2 Query: 53 DESSVGKDSDDDDIEGVRQRREQLSELKEAAYELLGKAWPKDYETQEKYQN 205 DE DSDDDD++G + SEL +E PKD Q+ N Sbjct: 420 DEDDGYIDSDDDDVDG--DDNDDGSELDGINFEDFAVHLPKDVNEQKDESN 468 >At5g36850.1 68418.m04415 hypothetical protein similar to At1g27780, At2g05560, At4g05280, At3g24385, At3g42590, At2g12110, At2g12100 Length = 231 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 166 GLAEQLVGRLFELRQLFASLPHALYVVVVRIFTHRRFVLG 47 G A++ R F LR A+ P A+Y +R+ TH R + G Sbjct: 71 GSADEGRHRTFFLRCFAANNPTAVYYEGIRVLTHERNING 110 >At3g44690.1 68416.m04806 expressed protein Length = 1176 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 80 DDDDIEGVRQRREQLSELKEAAYELLGKAWPKDYET 187 D +D G+R R L++ KEA ++ + KD+ET Sbjct: 759 DHEDARGLRYRGVSLNDRKEAYFQSESQQLLKDHET 794 >At1g27780.1 68414.m03399 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1468 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 166 GLAEQLVGRLFELRQLFASLPHALYVVVVRIFTHRRFVLG 47 G A++ R F LR A+ P A+Y +R+ TH R + G Sbjct: 1308 GSADEGRHRTFFLRCFTANNPTAVYYEGIRVLTHERNING 1347 >At5g40010.1 68418.m04852 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 514 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +2 Query: 14 SQVYEIVKVILSKDESSVGKDSDDDDIEGVRQRREQLSELKEAAYELLG-KAW 169 S VY+ ++ LSKD SS K + I+G + + + +E E G K W Sbjct: 67 SDVYDAIQSYLSKDSSSRAKKLTANTIKGNKSIILSMDDHEEITDEFQGVKVW 119 >At4g25730.1 68417.m03703 FtsJ-like methyltransferase family protein contains Pfam profile: PF01728 FtsJ-like methyltransferase Length = 821 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 59 SSVGKDSDDDDIEGVRQRREQLSELKEAAYE 151 S KDSD D E ++ EQ+ E+ E AYE Sbjct: 440 SDDSKDSDRDSDEERQKYTEQMEEIFEQAYE 470 >At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like family protein contains Pfam profile PF04091: Exocyst complex subunit Sec15-like Length = 771 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/46 (30%), Positives = 29/46 (63%) Frame = +2 Query: 449 GTPLKLWKYLSNN*KISKNPRTQ*AKENISELLEKSIEGFITRNQN 586 G PL++ + + ++K+ T A++ +S +L+K I+GF+T +N Sbjct: 545 GVPLRMAERGRRHFPLTKSQNT--AEDTLSGMLKKKIDGFMTLLEN 588 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,162,473 Number of Sequences: 28952 Number of extensions: 192853 Number of successful extensions: 928 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -