BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0781.Seq (743 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.7 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.3 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.3 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 4.0 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 7.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 7.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 7.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 7.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 7.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 7.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 7.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 7.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 7.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 7.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 7.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 7.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 7.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 7.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 7.0 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = -3 Query: 741 GLTILSKYPVHQ--HLMLTVCWMMLHWDPLQQQYSNKN---VRNLR 619 GLT++ V + L++T W+ L W+ + +++ + VR+LR Sbjct: 54 GLTLMQIIDVDEKNQLLITNLWLKLEWNDVNMRWNVSDYGGVRDLR 99 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 60 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 249 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 293 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D ++ N+ + L ++Y R+ + + L KNKR + +R Sbjct: 249 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYR 293 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 4.0 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -3 Query: 204 LIIFINIRQANINNVQAKH 148 L++FI ++ ++ N+Q +H Sbjct: 248 LLVFIGLQSLSLTNIQLEH 266 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 16 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 60 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 264 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 308 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 666 DPLQQQYSNKNVRNLRRSKYGEKYKRTDSKRKMLRKNKRSKKCFR 532 D Q N ++LR +Y R+ + + KN+R + +R Sbjct: 265 DRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYR 309 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,985 Number of Sequences: 438 Number of extensions: 4209 Number of successful extensions: 38 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -