BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0780.Seq (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 28 0.078 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.7 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 8.9 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 28.3 bits (60), Expect = 0.078 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 161 TLGTNWPALRRMMPRKPTSRSSKVS*LPSASRIKDLIF 274 +L + ALR+++P P+ + SK+ L A+R D +F Sbjct: 268 SLNEAFAALRKIIPTLPSDKLSKIQTLKLATRYIDFLF 305 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 372 WRQKSLMCADDAKKRAYLYSTLDNENYH 289 W QK L+ D +K LDN + H Sbjct: 255 WHQKELVRRDSRRKNYGGVYHLDNHHVH 282 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/30 (23%), Positives = 17/30 (56%) Frame = +1 Query: 166 WHKLAGTSKDDAQKAYIEIVEGLIASIGLK 255 +HK+A T +DD + ++ + + ++ K Sbjct: 110 FHKIALTCEDDVHRKFLHVNDECDVALSFK 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,859 Number of Sequences: 438 Number of extensions: 3124 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -