BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0779.Seq (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_28082| Best HMM Match : A2M_comp (HMM E-Value=0) 27 7.8 >SB_4089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -3 Query: 330 AFPLSSTSGTLSFRLSL--TLDLSASSF*KK--FPFLHHCP 220 AFPL T S LS+ TL S S KK FP L+HCP Sbjct: 123 AFPLQITDRRKSVALSVQETLSYSGPSGHKKQGFPVLNHCP 163 >SB_28082| Best HMM Match : A2M_comp (HMM E-Value=0) Length = 1013 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 359 SCYFLYLVKLPSRYL 315 SC FL+LVK PS YL Sbjct: 146 SCLFLFLVKTPSPYL 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,005,215 Number of Sequences: 59808 Number of extensions: 97930 Number of successful extensions: 161 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -