Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0778.Seq
         (788 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_3091| Best HMM Match : No HMM Matches (HMM E-Value=.)               52   7e-07

>SB_3091| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 30/72 (41%), Positives = 42/72 (58%)
 Frame = +2

Query: 47  LQEKFDQAAANVKNLKALPTYAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDAWH 226
           +Q+ F QA   V++LK L    +LL  Y  FKQAT G     +RPG  D+ GKAK+++WH
Sbjct: 13  VQDLFAQATDYVRSLKNLRDEQKLL-FYGLFKQATEGPCK-TSRPGFWDIVGKAKWESWH 70

Query: 227 KLAGTSKEDARK 262
           +     +E A K
Sbjct: 71  QHGKMPQEKAMK 82


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,262,788
Number of Sequences: 59808
Number of extensions: 404567
Number of successful extensions: 863
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 861
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2167838629
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)