BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0777.Seq (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.3 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 9.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.4 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 1.3 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -2 Query: 553 SPWAPQ--LRVLPALVVRSGRRFGSLGNRYQSGGV 455 +PW + + +LP L+V ++ NRY SG V Sbjct: 342 APWVKRVFIHILPRLLVMRRPQYKFETNRYSSGRV 376 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 1.3 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -2 Query: 553 SPWAPQ--LRVLPALVVRSGRRFGSLGNRYQSGGV 455 +PW + + +LP L+V ++ NRY SG V Sbjct: 342 APWVKRVFIHILPRLLVMRRPQYKFETNRYSSGRV 376 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 311 DRRRQTLADTSYVPQQENEVYYP 379 D QT++ T+ V Q+E E Y P Sbjct: 338 DLTTQTVSTTADVLQEEEEEYSP 360 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +2 Query: 311 DRRRQTLADTSYVPQQENEV--YYPQQPENPIFSPTQATELADPTEKIELYSTTLV 472 DR R+TL PQQ+ + QQ + P A PT+K + L+ Sbjct: 1437 DRDRKTLTSAPQQPQQQQQQQQQQQQQQQQLNHYPDLHNLYAVPTDKKSACDSKLI 1492 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 347 VPQQENEVYYPQQPE 391 VP + NE+YY PE Sbjct: 202 VPGKRNEIYYNCCPE 216 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.4 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = -2 Query: 547 WAPQLRVLPALVVRSGRRFG-SLGNRYQSGGVQFDLFSGVSQFGRLSGAEDRVLWLLRVI 371 W+P L P L R G G ++G R S FS VS G GAE R+ L Sbjct: 1027 WSPPL---PEL--RHGDIQGFNVGYRETSSSNPSYNFSSVSGDGEEGGAELRLTGLRPYT 1081 Query: 370 DFVFLLRYVAGIGKG 326 + +++ +G G Sbjct: 1082 KYTLVVQAYNQVGSG 1096 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.4 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = -2 Query: 547 WAPQLRVLPALVVRSGRRFG-SLGNRYQSGGVQFDLFSGVSQFGRLSGAEDRVLWLLRVI 371 W+P L P L R G G ++G R S FS VS G GAE R+ L Sbjct: 1023 WSPPL---PEL--RHGDIQGFNVGYRETSSSNPSYNFSSVSGDGEEGGAELRLTGLRPYT 1077 Query: 370 DFVFLLRYVAGIGKG 326 + +++ +G G Sbjct: 1078 KYTLVVQAYNQVGSG 1092 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,047 Number of Sequences: 438 Number of extensions: 4126 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -