BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0773.Seq (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80842-5|AAK71419.2| 305|Caenorhabditis elegans Serpentine rece... 30 1.5 >U80842-5|AAK71419.2| 305|Caenorhabditis elegans Serpentine receptor, class i protein50 protein. Length = 305 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 638 LKRFRKINNIFFYKWCYCFVFSRWTA*TLLLPLYLRVFN 522 + F K+NN Y+W + F+FS A T + LY + N Sbjct: 173 ISEFSKLNNFAIYQWSFWFIFSGIVA-TFGIVLYCIICN 210 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,041,054 Number of Sequences: 27780 Number of extensions: 329905 Number of successful extensions: 658 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -