BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0771.Seq (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016443-3|AAC24281.1| 395|Caenorhabditis elegans Hypothetical ... 28 5.5 U53147-1|AAA96112.1| 132|Caenorhabditis elegans Hypothetical pr... 27 9.7 >AF016443-3|AAC24281.1| 395|Caenorhabditis elegans Hypothetical protein C17E7.7 protein. Length = 395 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +3 Query: 360 KEYGSKPALNIG**LICYLCKMSFRRVL*LPMEY--KVNNSFF 482 K++GS+P L C CKM FRRV+ +EY K +N+ F Sbjct: 60 KDFGSQPKQV----LTCDACKMFFRRVVTEKLEYTCKCSNNCF 98 >U53147-1|AAA96112.1| 132|Caenorhabditis elegans Hypothetical protein C01B7.3 protein. Length = 132 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +3 Query: 63 VKVFTANKAFAETRKLYNVFVFIFYLKAWCLVLLTCLQIKT 185 VKV T K F + +++ I YLK WCL+LLT + I+T Sbjct: 7 VKVVT--KIFRKKQEIDEWVEVIVYLK-WCLLLLTEIIIQT 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,464,950 Number of Sequences: 27780 Number of extensions: 329934 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -