BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0770X.Seq (454 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0370 - 16333471-16333526,16333821-16333912,16334553-163346... 27 7.1 02_05_0386 - 28530882-28531172,28531261-28531413,28531500-28532483 27 9.3 >08_02_0370 - 16333471-16333526,16333821-16333912,16334553-16334671, 16335152-16335226,16335328-16335393,16335507-16335563, 16335640-16335689,16335774-16335944,16337057-16337183, 16337658-16338017 Length = 390 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 227 PKVRLPALIKTTHIQNELIYIIVAQ*ISLIGY 322 P V L A I+ HI IY +V + I +GY Sbjct: 223 PSVLLMAAIRNVHIARPTIYQVVKEMIDKMGY 254 >02_05_0386 - 28530882-28531172,28531261-28531413,28531500-28532483 Length = 475 Score = 26.6 bits (56), Expect = 9.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 171 DCQWNTKSIIRFSDLPII 224 DC W +S + FSD+P + Sbjct: 250 DCSWTPQSSVAFSDMPAL 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,017,942 Number of Sequences: 37544 Number of extensions: 160864 Number of successful extensions: 305 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -