BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0768.Seq (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0028 - 9802362-9802475,9802919-9803090,9803167-9803208,980... 29 4.8 09_01_0025 - 441528-444284 29 4.8 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 28 6.3 01_01_0094 - 730484-731570,732030-732715 28 6.3 12_02_1002 + 25176434-25176501,25176613-25176859,25178106-251781... 28 8.3 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 8.3 01_06_0956 - 33343503-33344086,33344225-33344384 28 8.3 >10_06_0028 - 9802362-9802475,9802919-9803090,9803167-9803208, 9803344-9804011,9804098-9804418,9804495-9804833, 9804856-9805109,9805300-9805510 Length = 706 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 594 LPPRSAPTEAPSGSRPDPSALSVAHVLLVRLNDTKLK 484 + PR APT P S P P+ +S+ + R D +L+ Sbjct: 464 ITPRPAPTSRPPPSHPHPTVVSLPSAVEERDEDLQLQ 500 >09_01_0025 - 441528-444284 Length = 918 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = -2 Query: 594 LPPRSAPTEAPSGSRPDPSALSVA 523 +P R +PT+ P+GS P PS+++++ Sbjct: 13 IPLRCSPTQPPAGSDPIPSSMNLS 36 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -3 Query: 251 LPKLAHLAPSSDLRLHRSSKPEFSPI 174 L L +LAP DLR+ SSKP F I Sbjct: 259 LETLVNLAPVLDLRIFSSSKPSFIKI 284 >01_01_0094 - 730484-731570,732030-732715 Length = 590 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 380 LSGFRLPWPPSCCHERPTPFMVSHERFLGALT 285 + G +LP P C + P P +V RF LT Sbjct: 552 VDGLQLPSRPFFCDDEPLPLLVDSYRFSSELT 583 >12_02_1002 + 25176434-25176501,25176613-25176859,25178106-25178171, 25178754-25178822,25179007-25179080,25180850-25180991, 25181546-25181596,25181769-25181774 Length = 240 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 567 PPSVQILVVVANTPARPW 620 PPS +LV+V P RPW Sbjct: 174 PPSSALLVIVEEGPTRPW 191 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -2 Query: 171 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 10 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 >01_06_0956 - 33343503-33344086,33344225-33344384 Length = 247 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 639 PSPRQSSRASLEYLLLPPRSAPTEAPSGSRPDPSALSVAH 520 PSPR R + + LPP AP +P+ P P+A H Sbjct: 135 PSPRHKRRTAPAPMPLPPAQAPVWSPA---PAPAATQRRH 171 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,828,724 Number of Sequences: 37544 Number of extensions: 484923 Number of successful extensions: 1600 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1599 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -