BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0768.Seq (706 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 4e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 8e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 48 1e-05 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 42 6e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 33 0.17 SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 29 3.7 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.7 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 29 4.9 SB_41657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_24983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_49634| Best HMM Match : RTC_insert (HMM E-Value=3.5) 28 8.5 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 342 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 342 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 342 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 139 GASLGETASSADLGGSSKYSNESFEDRSGERF 170 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 342 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 363 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 61 GASLGETASSADLGGSSKYSNESFEDRSGERF 92 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 363 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 363 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 369 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 461 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 678 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSA 577 DRLT QLLFT N SP +SS+ S EYLLLPPRSA Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSA 122 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 372 SAKECATTHLPKQPALKMDGAEAFCLYTTV 461 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 372 SAKECATTHLPKQPALKMDGAEAFCLYTTV 461 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 372 SAKECATTHLPKQPALKMDGAEAFCLYTTV 461 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 372 SAKECATTHLPKQPALKMDGAEAFCLYTTV 461 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +1 Query: 286 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 396 ++ +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 375 AKECATTHLPKQPALKMDGAEAFCLYTTV 461 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +1 Query: 286 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 381 ++ +RS D KGVG S QQDGGHGS NP + Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 87 GASLGETASSADLGGSSKYSNESFEDRSGERF 118 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -1 Query: 658 TTVHAKPFSTSVLQGLAGVFATTTKICTDG 569 T VH +PFSTSV + L +FATTTKICT G Sbjct: 113 TAVHMEPFSTSVFKALIRIFATTTKICTGG 142 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +1 Query: 286 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 381 ++ +RS D KGVG S QQDGGHGS NPL+ Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +3 Query: 378 KECATTHLPKQPALKMDGAEAFCLYTTV 461 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 563 GASVG-----ADLGGSSKYSSEALED*RGEGF 643 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 87 GASLGETASSADLGGSSKYSNESFEDRSGERF 118 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 7/47 (14%) Frame = -1 Query: 658 TTVHAKPFSTSVLQGLAGVFATTTKICTDG----GSKR---LTPRPF 539 T VH PFSTS Q L +FATTTKIC G GS + TP PF Sbjct: 48 TAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPTPF 94 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 302 NAHGTP*KALVAHDSRTVAMEVGIR 376 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 363 KSESAKECATTHLPKQPALKM 425 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -1 Query: 253 AYQNWPTWHRHQISGFIVRVSRSSHPFKV 167 AYQ WPT + H +SGF SR+S+ FKV Sbjct: 30 AYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = -2 Query: 279 FGSSHSASLLTKIGPLGTVIRSPASSFE*AGVLTHLKFENR 157 FGSS AS + GP T I P + + G+LT+LKFENR Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFENR 117 >SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +3 Query: 570 PSVQILVVVANTPARPWRTDVEKG 641 P VQILVVVAN R +T+VEKG Sbjct: 39 PPVQILVVVANIQMRALKTEVEKG 62 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 450 IGKTLQRHPFSGLVVSA 400 IG TL+RHPFSGLV SA Sbjct: 24 IGATLERHPFSGLVASA 40 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 70 AYQKWPTRNSHSLSGF 85 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 450 IGKTLQRHPFSGLVVSA 400 IG TL+RHPFSGLV SA Sbjct: 22 IGATLERHPFSGLVASA 38 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 68 AYQKWPTSNSHSLSGF 83 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 32.7 bits (71), Expect = 0.30 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = -2 Query: 291 LNTTFGSSHSASLLTKIGPLGTVIRSPAS 205 LN FGSS AS + GPLGT I PAS Sbjct: 17 LNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 67 AYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 68 AYQKWPTRNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 109 AYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 394 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 299 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 30 AYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 253 AYQNWPTWHRHQISGF 206 AYQ WPT + H +SGF Sbjct: 152 AYQKWPTRNSHSLSGF 167 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 633 PRQSSRASLEYLLLPPRSAPTEAPSGSRPDP 541 PR +S++S+ + PP S P AP+ +P P Sbjct: 165 PRTTSQSSIPGVAPPPSSQPAPAPAPPQPAP 195 >SB_41657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 28.3 bits (60), Expect = 6.4 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 3/94 (3%) Frame = -3 Query: 344 CHERPTPFMVSHERFLGALTLRLVHPTAPVCLPKLAH---LAPSSDLRLHRSSKPEFSPI 174 CH+R P +V LGAL LR+ A + AH AP L+ + K + S + Sbjct: 243 CHKRDVPVLVDGAHALGALPLRIAELGADYYVAN-AHKWLCAPKGCAALYVADKHKGS-V 300 Query: 173 *SLRIG*GRFGPNASNHSLYRMRLF*NFISTPAI 72 L + G FG + L+R+ F +S I Sbjct: 301 RCLTVS-GGFGRGFTTEFLFRVLDFWETVSPDRI 333 >SB_24983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 398 VSRC-TLLSGFRLPWPPSCCHERPTPFMVSHERFLGALTLRLVHPTAPVCLPKL 240 +++C TLL G ++ SC P ++ H +G L ++ H P P+L Sbjct: 1 MNKCETLLRGMQIIGRVSCSSAPPIVVVLPHGSAVGRLPIQSAHDKNPAISPRL 54 >SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 359 WPPSCCHERPTPFMVSHERFLGALTLRLVHPTAPVCLPKL 240 W P CC R ++ +ER G+L LR P + + +P L Sbjct: 209 WLPRCCQSRTNVHVLVYER--GSLELRTEVPDSNIEIPVL 246 >SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 584 LGGSSKYSSEALED*RG 634 LGGSSKYS+E+ ED G Sbjct: 2 LGGSSKYSNESFEDRSG 18 >SB_49634| Best HMM Match : RTC_insert (HMM E-Value=3.5) Length = 564 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -2 Query: 321 HGVP*AFFRRLNTTFGSSHS---ASLLTKIGPLGTVIRSPASSF 199 H VP A F G+ H+ A+ TK+GP+GT P ++F Sbjct: 272 HTVPWAAFNTKVGPVGTCHTVPWAAFNTKVGPVGTCHTVPCTAF 315 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,790,699 Number of Sequences: 59808 Number of extensions: 496755 Number of successful extensions: 2225 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 2039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2221 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -