BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0768.Seq (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 4.1 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 24 5.4 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 24 5.4 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 24 5.4 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 24 5.4 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.1 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 23 9.4 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 9.4 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 644 ETLLHVSPPGPRWSICYYHQDLHRRRLQAA 555 +++ ++S P WSI Y+ +D+ +QAA Sbjct: 210 QSVRNLSRPITGWSIKYFSKDIFEVMMQAA 239 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 325 GVGRS*QQDGGHGSRNPLRSVQRLTCRNNQ 414 G G + GG GS P + L C++N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 325 GVGRS*QQDGGHGSRNPLRSVQRLTCRNNQ 414 G G + GG GS P + L C++N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 325 GVGRS*QQDGGHGSRNPLRSVQRLTCRNNQ 414 G G + GG GS P + L C++N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 325 GVGRS*QQDGGHGSRNPLRSVQRLTCRNNQ 414 G G + GG GS P + L C++N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 7.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 645 RNPSPRQSSRASLEYLLLPPRSAPTEAPSG 556 RN ++ RAS ++PPRS A G Sbjct: 225 RNQHEQEQPRASTSRAVMPPRSEALTAVRG 254 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 23.0 bits (47), Expect = 9.4 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -3 Query: 446 AKRFSAIHFQGWLFRQVSRCTLLSGFR 366 A+ +A+H W+++ + C + S R Sbjct: 69 ARAINALHHIDWVYKHTNNCKIESASR 95 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 469 VPVTVVYRQNASAPSIFRAGCFGR*VVAHS 380 +P+ V+ ++N +AP+ + A C R H+ Sbjct: 36 IPLEVLEQENGTAPADWSASCTQRRTEDHA 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,531 Number of Sequences: 2352 Number of extensions: 16208 Number of successful extensions: 265 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -