BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0768.Seq (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-6|CAB54458.2| 625|Caenorhabditis elegans Hypothetical pr... 29 3.2 Z99281-5|CAB54457.1| 553|Caenorhabditis elegans Hypothetical pr... 29 3.2 Z78418-3|CAB01697.1| 932|Caenorhabditis elegans Hypothetical pr... 24 6.1 U61946-10|AAC24388.1| 1827|Caenorhabditis elegans Hypothetical p... 27 9.9 >Z99281-6|CAB54458.2| 625|Caenorhabditis elegans Hypothetical protein Y57G11C.9b protein. Length = 625 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 645 RNPSPRQSSRASLEYLLLPPRSAPTEAPSGSRPDPSA 535 R P++S + L + LPP++ +PS + P P A Sbjct: 278 RETQPKKSVKEELPQIPLPPKTEAAASPSPAPPTPKA 314 >Z99281-5|CAB54457.1| 553|Caenorhabditis elegans Hypothetical protein Y57G11C.9a protein. Length = 553 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 645 RNPSPRQSSRASLEYLLLPPRSAPTEAPSGSRPDPSA 535 R P++S + L + LPP++ +PS + P P A Sbjct: 278 RETQPKKSVKEELPQIPLPPKTEAAASPSPAPPTPKA 314 >Z78418-3|CAB01697.1| 932|Caenorhabditis elegans Hypothetical protein F25D7.4 protein. Length = 932 Score = 23.8 bits (49), Expect(2) = 6.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 582 SAPTEAPSGSRPDPSALSV 526 SAP AP SR DP+ +++ Sbjct: 428 SAPATAPEASRRDPNDVTI 446 Score = 22.6 bits (46), Expect(2) = 6.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 648 TRNPSPRQSSRASLEYLLLPPRSAPTEAP 562 TR P P +S+ A PPR AP +AP Sbjct: 368 TRAPIPARSAPA-------PPRGAPAKAP 389 >U61946-10|AAC24388.1| 1827|Caenorhabditis elegans Hypothetical protein F47C12.1 protein. Length = 1827 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 348 GRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFLI 491 G W K + + A THLP+ K++ + F C++ F I Sbjct: 393 GTWSSKQPNCTKVACTHLPEVANAKIEVPDRFLFGDVARVVCNSGFTI 440 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,475,954 Number of Sequences: 27780 Number of extensions: 359456 Number of successful extensions: 938 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -