BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0766.Seq (683 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces ... 29 0.47 SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting... 28 1.1 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 27 3.3 >SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 29.5 bits (63), Expect = 0.47 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 120 FSFLHCKLNNLIYFHKFVFYTIIKYNENYLSPRECCLKR 236 F+++ C L+ + YF F + YN NY+SP +R Sbjct: 64 FAYMECVLSWIAYFFGFDKAMLDPYNLNYVSPSTVVFQR 102 >SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting complex subunit Apc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +3 Query: 75 IQNNLSTNTYIITN*FSFLHCKLNNLIYFHKFVF---YTIIKYN 197 +++ L+T Y+ N FSFL+C Y F+ Y I+++N Sbjct: 398 VEDCLATLGYLQNNVFSFLNCLFEEKKYMKHFISWLNYAIVEFN 441 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 26.6 bits (56), Expect = 3.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 547 FIYFFTFGKISIVTVHLTNLYN 612 F+YF F ISI+ + +T +Y+ Sbjct: 821 FVYFSNFKNISIICIAMTKIYS 842 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,692,941 Number of Sequences: 5004 Number of extensions: 55405 Number of successful extensions: 83 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -