BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0762X.Seq (486 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.28 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 4.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 4.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 5.9 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 5.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.4 bits (53), Expect = 0.28 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 256 KTRRVTLKPGCTLMLKPP*PYSRAGIEPSRGRSF 155 K + T+KP T+ +P P A + P +GR F Sbjct: 2209 KPKPTTMKPTTTIGYEPQEPVLPAEVVPCQGRLF 2242 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -1 Query: 432 MVRRAGRVYRSDTRYSAAAW 373 ++R GR++R+ R + A+W Sbjct: 300 VMRELGRIFRAYCRENHASW 319 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 4.5 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +1 Query: 412 APRPPHHPGGLQRRP--ARSRLHQPA 483 A + P GG +R P ARSR H PA Sbjct: 318 AVQVPQLAGGGRRGPGPARSRRHLPA 343 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 354 CLFSSRPALCH 322 C+FS RP L H Sbjct: 282 CIFSLRPGLTH 292 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 5.9 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 52 EKLQSKDSTRRSTRPNRYSTPVKTAPKYPCSLYRKRICRATAR 180 EKL+++D R+ N Y V + Y S+ + R A+ Sbjct: 117 EKLKTRDQKERNLFKNAYFQLVLSISVYSSSVGYTQYVRIAAK 159 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,460 Number of Sequences: 336 Number of extensions: 1704 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -