BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0759.Seq (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 65 6e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 61 8e-10 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 61 1e-09 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 60 1e-09 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 59 3e-09 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 59 4e-09 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 58 5e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 58 7e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 58 7e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 58 7e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 58 7e-09 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 58 7e-09 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 58 7e-09 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 58 7e-09 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 58 7e-09 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 58 7e-09 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 58 7e-09 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 58 7e-09 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 58 7e-09 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 58 7e-09 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 58 7e-09 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 58 7e-09 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 58 7e-09 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 58 7e-09 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 58 7e-09 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 58 7e-09 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 58 7e-09 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 58 7e-09 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 58 7e-09 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 58 7e-09 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 58 7e-09 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 58 7e-09 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 58 7e-09 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 58 7e-09 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 58 7e-09 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 58 7e-09 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 58 7e-09 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 58 7e-09 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 58 7e-09 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 58 7e-09 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 58 7e-09 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 58 7e-09 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 58 7e-09 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 58 7e-09 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 58 7e-09 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 58 7e-09 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 58 7e-09 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 58 7e-09 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 58 7e-09 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 58 7e-09 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 58 7e-09 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 58 7e-09 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 58 7e-09 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 58 7e-09 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 58 7e-09 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 58 7e-09 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 58 7e-09 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 58 7e-09 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 58 7e-09 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_13997| Best HMM Match : EGF_CA (HMM E-Value=1.2e-05) 56 3e-08 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 55 5e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 55 5e-08 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 55 5e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 55 5e-08 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 55 5e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 55 5e-08 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 55 5e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 55 5e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 55 5e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 55 5e-08 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 55 5e-08 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 55 5e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 55 5e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 55 5e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 55 5e-08 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 55 5e-08 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 55 5e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 55 5e-08 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 55 5e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 55 5e-08 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 55 5e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 55 5e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 55 5e-08 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 55 5e-08 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 55 5e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 55 5e-08 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 55 5e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 55 5e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46255| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46237| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_46079| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45828| Best HMM Match : S-antigen (HMM E-Value=0.0095) 55 5e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45770| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45428| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45376| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45360| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 64.9 bits (151), Expect = 6e-11 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRMANCKR*YFVKIR 121 PPFASWRNSEEARTDRPSQQLRSL +WR+ C + Y ++R Sbjct: 77 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQNYTTRLR 118 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 61.7 bits (143), Expect = 6e-10 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRMANCKR 100 PPFASWRNSEEARTDRPSQQLRSL +WR+ C + Sbjct: 194 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 61.3 bits (142), Expect = 8e-10 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRMANCKR 100 PPFASWRNSEEARTDRPSQQLRSL +WR+ KR Sbjct: 75 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 2/38 (5%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRMANCKR*YF 109 PPFASWRNSEEARTDRPSQQLRSL +WR+ R Y+ Sbjct: 215 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRDYY 252 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 60.5 bits (140), Expect = 1e-09 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 86 PFAIAGCATVGKGDRCGPLRYYASWRKG 3 P +GCATVGKGDRCGPLRYYASWRKG Sbjct: 239 PIRHSGCATVGKGDRCGPLRYYASWRKG 266 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 74 AGCATVGKGDRCGPLRYYASWRKG 3 +GCATVGKGDRCGPLRYYASWRKG Sbjct: 89 SGCATVGKGDRCGPLRYYASWRKG 112 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 72 RLRNCWEGRSVRASSLLRQLAKGG 1 RLRNCWEGRSVRASSLLRQLAKGG Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGG 46 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 58.8 bits (136), Expect = 4e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 71 GCATVGKGDRCGPLRYYASWRKG 3 GCATVGKGDRCGPLRYYASWRKG Sbjct: 30 GCATVGKGDRCGPLRYYASWRKG 52 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRMANCKR 100 PPFASWRNSEEARTDRPSQQLRSL +WR+ +R Sbjct: 222 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQR 256 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 58.4 bits (135), Expect = 5e-09 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRMANCK 97 PPFASWRNSEEARTDRPSQQLRSL +WR+ + Sbjct: 553 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 39 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 49 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 52 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 857 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 138 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 35 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 43 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 30 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 59 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 156 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 177 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 45 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 71 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 237 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 57 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 72 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 99 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 124 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 52 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 170 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 124 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 1214 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 72 RLRNCWEGRSVRASSLLRQLAKGG 1 RLRNCWEGRSVRASSLLRQLAKGG Sbjct: 408 RLRNCWEGRSVRASSLLRQLAKGG 431 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 56 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 149 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 101 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 55 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 120 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 85 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 45 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 48 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 132 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 48 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 67 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 100 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 115 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 1087 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 55 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 158 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 206 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 43 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 170 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 140 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 47 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 676 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 185 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 71 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 56 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 94 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 55.2 bits (127), Expect = 5e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL 73 PPFASWRNSEEARTDRPSQQLRSL Sbjct: 19 PPFASWRNSEEARTDRPSQQLRSL 42 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 95 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 103 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 209 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 468 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 290 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 85 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 94 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 128 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 49 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 98 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 69 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 107 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 200 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 55 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 107 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 166 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 92 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 105 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 111 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 128 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 150 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 67 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 118 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 191 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 66 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 57 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 103 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 129 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 70 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 143 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 176 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 126 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 50 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 119 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 148 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 180 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 51 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 150 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 113 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 50 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 95 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 109 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 117 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 169 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 96 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 815 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 96 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 117 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 131 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 105 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 132 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 330 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 54 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 76 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 39 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 50 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 271 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 105 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 72 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 48 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 228 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 257 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 743 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 772 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 211 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 240 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 139 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 168 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 54 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 109 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 35 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 56 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 133 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 162 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 45 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 39 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 45 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 51 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 48 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 145 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 174 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 388 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 417 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 105 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = +2 Query: 2 PPFASWRNSEEARTDRPSQQLRSL--QWRM 85 PPFASWRNSEEARTDRPSQQLRSL +WR+ Sbjct: 461 PPFASWRNSEEARTDRPSQQLRSLNGEWRL 490 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,888,812 Number of Sequences: 59808 Number of extensions: 421680 Number of successful extensions: 8283 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8281 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -