BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0756.Seq (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 66 3e-13 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 66 3e-13 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 60 2e-11 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 29 0.039 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.84 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.6 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.4 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.4 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 66.1 bits (154), Expect = 3e-13 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 640 LSFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 741 L FDLGGGTFDVS+LTIE+GIFEVK+TAGDTH G Sbjct: 24 LIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG 57 Score = 48.8 bits (111), Expect = 5e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +3 Query: 570 INEPTAAAIAYGLDKKGTGERNVLIF 647 INEPTAAAIAYGLDKK ERNVLIF Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIF 26 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 66.1 bits (154), Expect = 3e-13 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 640 LSFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 741 L FDLGGGTFDVS+LTIE+GIFEVK+TAGDTH G Sbjct: 24 LIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG 57 Score = 48.8 bits (111), Expect = 5e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +3 Query: 570 INEPTAAAIAYGLDKKGTGERNVLIF 647 INEPTAAAIAYGLDKK ERNVLIF Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIF 26 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 59.7 bits (138), Expect = 2e-11 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 640 LSFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 741 L +DLGGGTFDVSILTI++G+FEV +T+GDTH G Sbjct: 23 LVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLG 56 Score = 44.4 bits (100), Expect = 1e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +3 Query: 570 INEPTAAAIAYGLDKKGTGERNVLIF 647 INEPTAAAIAYGLDKKG E+N+L++ Sbjct: 1 INEPTAAAIAYGLDKKG-AEQNILVY 25 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 29.1 bits (62), Expect = 0.039 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 163 DHSVLCCVHRHRASHRRCRQEPGGDEPQQHKFDAKRLI--GRKFEDATVQADMKHWPFEV 336 DH + +H + SH +QEP G H F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398 Query: 337 VS 342 +S Sbjct: 399 LS 400 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 629 TKCTYLLTSAAVPSTCPSLPSRMVSSR*NPPPATPT 736 T+C +S PST P +P + V++ + P T T Sbjct: 2282 TECHPDASSTMAPSTTPMVPDKPVTTTTSRPIGTDT 2317 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 343 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 468 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 115 LPAREGGDHRQRPGQQDH 168 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 525 TKDAGTISGLNVLRIINEPTAA 590 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,164 Number of Sequences: 336 Number of extensions: 4314 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -