BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0754.Seq (689 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0462 + 9583558-9584910 30 2.0 12_01_0371 - 2851186-2851491,2851582-2851765,2851967-2852156,285... 29 2.6 >09_02_0462 + 9583558-9584910 Length = 450 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 183 WYKKQIYGNKSSYLVYNAKN*INWL 109 WY + + G K S +V NAK + WL Sbjct: 416 WYNESVAGGKESQVVKNAKPFVEWL 440 >12_01_0371 - 2851186-2851491,2851582-2851765,2851967-2852156, 2853375-2853613,2853862-2853947,2854720-2854827, 2854929-2855031,2855152-2855213 Length = 425 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 452 KADNFIYDLCNLCKSLVLQYS-MSKILASQRDALF 351 + D FIY LC++ VL+ S + ILAS R+ +F Sbjct: 101 EVDEFIYQLCDVTGDEVLERSDLETILASIRETIF 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,878,778 Number of Sequences: 37544 Number of extensions: 263477 Number of successful extensions: 367 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -