BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0749.Seq (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 26 1.1 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 26 1.5 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 24 6.0 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 24 6.0 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 23 7.9 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 7.9 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 7.9 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 7.9 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 23 7.9 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 630 IVNVFHRQFYRRTHRFCGITHVVVRLILRFQAIVDLNSF 514 ++NVFH R+ F G T +L L +A + SF Sbjct: 144 VINVFHHIKQVRSQNFVGKTQSYSKLYLLLKATLSAQSF 182 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 32 WSTSS*PLLRSTAAGCGSTAHVKEA 106 W +S P + TAAG GST KE+ Sbjct: 245 WGSSDDPEIEYTAAGWGSTESGKES 269 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 6.0 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 296 MQRHHRLLAYHPYMYMVHIADF 361 ++R H+L + PY ++ + DF Sbjct: 180 LERLHQLTSVKPYQLLIEVEDF 201 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 294 TCNVITGFSPTIHTCTW 344 TC T F P +H C W Sbjct: 500 TCPPGTLFDPALHICNW 516 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -2 Query: 296 CAGDPATRSRCLVGQIQHYLMDHYQIEHATIQM 198 C G R L +Q Y+MD + + + I + Sbjct: 50 CQGKQKARKVLLTPALQAYIMDEHNLNRSNIAL 82 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 153 TTTTPIWTDPT 163 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 153 TTTTPIWTDPT 163 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 153 TTTTPIWTDPT 163 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 152 TTTTPVWTDPT 162 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 152 TTTTPVWTDPT 162 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 153 TTTTPIWTDPT 163 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 153 TTTTPIWTDPT 163 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 276 TITMPCWTDPT 244 T T P WTDPT Sbjct: 153 TTTTPVWTDPT 163 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -2 Query: 296 CAGDPATRSRCLVGQIQHYLMDHYQIEHATIQM 198 C G R L +Q Y+MD + + + I + Sbjct: 50 CQGKQKARKVLLTPALQAYIMDEHNLNRSNIAL 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 895,172 Number of Sequences: 2352 Number of extensions: 22541 Number of successful extensions: 307 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -