BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0746.Seq (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 1.6 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.3 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = -3 Query: 176 NGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADY 36 N W F + ++L D P+I+ S + Y I HA Y Sbjct: 213 NNSKWDFKVIKATKVLKMYACCPNDTYPMIVYEFSISRHYGILHATY 259 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 176 NGGGWFFNLDYDKE 135 N GW+ N DY+ E Sbjct: 204 NYSGWYLNHDYNLE 217 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 176 NGGGWFFNLDYDKE 135 N GW+ N DY+ E Sbjct: 204 NYSGWYLNHDYNLE 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,976 Number of Sequences: 438 Number of extensions: 3814 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -