BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0743.Seq (682 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 1.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 1.8 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 2.3 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 23 3.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.3 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 9.3 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 95 FSRQLRHDLRSI-N*KEESSCFISNSTSNEC 6 F R +R + + + K+E SC I + N+C Sbjct: 62 FKRSIRRNRQYVCKAKDEGSCIIDKTHRNQC 92 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 95 FSRQLRHDLRSI-N*KEESSCFISNSTSNEC 6 F R +R + + + K+E SC I + N+C Sbjct: 62 FKRSIRRNRQYVCKAKDEGSCIIDKTHRNQC 92 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 129 LPQTPYGGLTPILPP 85 LPQ P L PI PP Sbjct: 177 LPQVPPLPLPPIFPP 191 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 136 LSASSNALRRFDSDSPASLDMISGPLIKK 50 L N L + D DSPA +++ P KK Sbjct: 109 LQLDENKLDKKDDDSPALRALLTRPQAKK 137 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 21 AVANETGAFFFLINGPE 71 A+A + G+F L+ GPE Sbjct: 70 ALAEQLGSFITLVGGPE 86 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 233 VIDAYGWLKK 262 +I A+GWLKK Sbjct: 119 IIFAFGWLKK 128 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 274 DRDGGHEPAELHRPGAA 324 D +G H P LH G A Sbjct: 41 DEEGYHTPESLHYEGRA 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,581 Number of Sequences: 336 Number of extensions: 2497 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -