BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0739.Seq (743 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_42362| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_43253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 224 MYIFSFLFGEIGTYVG*LGTRLENLGTRKHKIGTPKDKIGMA 349 +Y + IGT + +GT + +GT K+ +GT + IG A Sbjct: 26 IYCMGYTVNYIGTAIYCMGTTVNYIGTAKYCMGTTVNYIGTA 67 >SB_42362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 235 FLSFWGNWDVCRVIGNETGKLRDEKTQNWNAKRQN 339 F+ W N ++ R + N KLR+ W A++ + Sbjct: 278 FIYCWRNREIKRAVQNTLAKLRETLLSRWTAQKNS 312 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,858,938 Number of Sequences: 59808 Number of extensions: 377680 Number of successful extensions: 1005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -