BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0739.Seq (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341191-1|AAR13755.1| 191|Anopheles gambiae GNBP B1 protein. 24 4.3 AY341190-1|AAR13754.1| 191|Anopheles gambiae GNBP B1 protein. 24 4.3 AY341189-1|AAR13753.1| 191|Anopheles gambiae GNBP B1 protein. 24 4.3 AY341188-1|AAR13752.1| 191|Anopheles gambiae GNBP B1 protein. 24 4.3 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 24 4.3 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 24 4.3 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 23 10.0 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 10.0 >AY341191-1|AAR13755.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 270 GNWERDWKT*GRENTKLE 323 GNWE W T R N+ +E Sbjct: 68 GNWEFQWYTNNRSNSFVE 85 >AY341190-1|AAR13754.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 270 GNWERDWKT*GRENTKLE 323 GNWE W T R N+ +E Sbjct: 68 GNWEFQWYTNNRSNSFVE 85 >AY341189-1|AAR13753.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 270 GNWERDWKT*GRENTKLE 323 GNWE W T R N+ +E Sbjct: 68 GNWEFQWYTNNRSNSFVE 85 >AY341188-1|AAR13752.1| 191|Anopheles gambiae GNBP B1 protein. Length = 191 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 270 GNWERDWKT*GRENTKLE 323 GNWE W T R N+ +E Sbjct: 68 GNWEFQWYTNNRSNSFVE 85 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 270 GNWERDWKT*GRENTKLE 323 GNWE W T R N+ +E Sbjct: 86 GNWEFQWYTNNRSNSFVE 103 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 270 GNWERDWKT*GRENTKLE 323 GNWE W T R N+ +E Sbjct: 86 GNWEFQWYTNNRSNSFVE 103 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.0 bits (47), Expect = 10.0 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 327 GVPILCFLVPKFSSLVPNYPTYVPISPKRKE-KIYIFYFVEI 205 G+ +C PK S + NYP+ I P KE K Y+ +++ Sbjct: 48 GMRKVCMSRPKISEEMANYPSQ-GIFPDDKEFKCYVACLMDL 88 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 10.0 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = +1 Query: 307 KTQNWNAKRQNRDGLLGLSLISNNRFFSLYYHL 405 + +W A+++ L ++S +RFF + H+ Sbjct: 906 EVHSWMAQKRGEVDFLLAQILSGHRFFREFLHV 938 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,323 Number of Sequences: 2352 Number of extensions: 11901 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -