BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0738.Seq (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_26081| Best HMM Match : Ribosomal_S8 (HMM E-Value=3.8) 28 7.4 >SB_50789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 431 SAC*KWADGTVLCHIYKFCVKRQLYKSV*QILKIVIS 541 SA +W G++ C +Y FC K +Y S+ I I ++ Sbjct: 194 SALGRWVYGSLGCQLYGFCSKFLVYVSIYTISLIALN 230 >SB_26081| Best HMM Match : Ribosomal_S8 (HMM E-Value=3.8) Length = 426 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 6/63 (9%) Frame = +3 Query: 399 KKNTYSKYDNIQHARNGLMALYYA---ISISFASNDNFI---NQCSKF*KSSYRLLGKFE 560 K+N YSKY +++++ G M+ A SI + F C K Y L GKF Sbjct: 22 KENIYSKYKSLKYSVQGCMSSCLANSEFSICNCTEGKFRVKGRPCFSESKGKYMLKGKFR 81 Query: 561 ART 569 +T Sbjct: 82 VKT 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,259,157 Number of Sequences: 59808 Number of extensions: 395974 Number of successful extensions: 785 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -