BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0735X.Seq (359 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 3.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 5.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 5.9 DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. 20 7.7 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 20 7.7 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 20 7.7 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 3.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 96 GMCKAGFAGD 125 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 20.6 bits (41), Expect = 5.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 16 QRPQHKHTQSSRCATTMLLRL*STMAPACARPVSPAT 126 +RPQ+K + + +L+R C P P+T Sbjct: 360 RRPQYKFETNRYSSGRVLMRTVRGKEKTCYYPYHPST 396 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 20.6 bits (41), Expect = 5.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 16 QRPQHKHTQSSRCATTMLLRL*STMAPACARPVSPAT 126 +RPQ+K + + +L+R C P P+T Sbjct: 360 RRPQYKFETNRYSSGRVLMRTVRGKEKTCYYPYHPST 396 >DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. Length = 135 Score = 20.2 bits (40), Expect = 7.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -2 Query: 52 ILNFVCVCVG 23 I++ +CVCVG Sbjct: 6 IISAICVCVG 15 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 20.2 bits (40), Expect = 7.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -2 Query: 52 ILNFVCVCVG 23 I++ +CVCVG Sbjct: 6 IISAICVCVG 15 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 20.2 bits (40), Expect = 7.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -2 Query: 52 ILNFVCVCVGDAGI 11 I++ +C+CVG I Sbjct: 6 IISAICICVGALSI 19 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,524 Number of Sequences: 438 Number of extensions: 1803 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8432340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -