BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0731.Seq (719 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK127156-1|BAC86859.1| 204|Homo sapiens protein ( Homo sapiens ... 30 7.3 AB002308-1|BAA20769.4| 2388|Homo sapiens KIAA0310 protein protein. 30 7.3 >AK127156-1|BAC86859.1| 204|Homo sapiens protein ( Homo sapiens cDNA FLJ45218 fis, clone BRCAN2019653. ). Length = 204 Score = 30.3 bits (65), Expect = 7.3 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +1 Query: 535 PASRACRPAVVLSTVGCRWRSVRQSFCNPL-TPAILQAAFLANGWSRRQGSTNG 693 P SR PAV GC W +S NP Q F+A WS + G G Sbjct: 100 PESRRLLPAVPAPAEGCWWWCWGRSALNPCDRKGRYQKRFIAFSWSGQPGPFEG 153 >AB002308-1|BAA20769.4| 2388|Homo sapiens KIAA0310 protein protein. Length = 2388 Score = 30.3 bits (65), Expect = 7.3 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -1 Query: 584 QPTVDRTTAGRQALEAGLVLRSASSSTSLGLVEAGLGISALPGLAMPH 441 QP D RQAL++ + S+ SS + A G S PGL +PH Sbjct: 80 QPVTDPFAFSRQALQSTPLGSSSKSSPPVLQGPAPAGFSQHPGLLVPH 127 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,057,720 Number of Sequences: 237096 Number of extensions: 2230836 Number of successful extensions: 5895 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5892 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -