BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0731.Seq (719 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060698-1|AAL28246.1| 356|Drosophila melanogaster GH14075p pro... 32 0.90 AE014297-3033|AAF55913.2| 693|Drosophila melanogaster CG31177-P... 32 0.90 >AY060698-1|AAL28246.1| 356|Drosophila melanogaster GH14075p protein. Length = 356 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 7/41 (17%) Frame = -2 Query: 661 HWPKKQ-------LVEWQELVGYKMIGVRSSSGNRLLIEQQ 560 HWPK Q L ++ E VGY MI V++ GN+++ +Q Sbjct: 132 HWPKNQDVDLVDFLTDYTEQVGYPMIIVKALQGNKVVTVEQ 172 >AE014297-3033|AAF55913.2| 693|Drosophila melanogaster CG31177-PA protein. Length = 693 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 7/41 (17%) Frame = -2 Query: 661 HWPKKQ-------LVEWQELVGYKMIGVRSSSGNRLLIEQQ 560 HWPK Q L ++ E VGY MI V++ GN+++ +Q Sbjct: 469 HWPKNQDVDLVDFLTDYTEQVGYPMIIVKALQGNKVVTVEQ 509 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,796,702 Number of Sequences: 53049 Number of extensions: 704548 Number of successful extensions: 2137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2137 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3211306956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -